NUDCD2 Recombinant monoclonal antibody, PBS Only (Detector)

NUDCD2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83217-4-PBS
Clone No.230513F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

230513F10, NudC domain containing 2, NudC domain-containing protein 2, NudCL2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83217-4-PBS targets NUDCD2 as part of a matched antibody pair:

MP00205-2: 83217-2-PBS capture and 83217-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15579

Product name: Recombinant human NUDCD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-157 aa of BC017934

Sequence: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK

Predict reactive species
Full Name NudC domain containing 2
Calculated Molecular Weight 157 aa, 18 kDa
GenBank Accession NumberBC017934
Gene Symbol NUDCD2
Gene ID (NCBI) 134492
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WVJ2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NUDCD2, also known as NudCL2, is an HSP90 cochaperone that regulates sister chromatid cohesion during mitosis. NUDCD2 also plays a role in ciliogenesis(PMID: 30368549, 34480124). NUDCD2 regulates the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone(PMID: 20133715).

Loading...
||
New chat

Able

正在加载,请稍候...