NUDT3/4/10/11 Polyclonal antibody

• 

  WB analysis using 10912-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10912-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10912-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10912-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NUDT3/4/10/11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10912-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

APS1, ASP1, DIPP 3 beta, DIPP3 beta, DIPP3b, DIPP3beta, hAps1, hDIPP3beta, Nudix motif 11, NUDT11

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue
• Positive IHC detected in: mouse testis tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

10912-1-AP targets NUDT3/4/10/11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1346

  Product name: Recombinant human NUDT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC009942

  Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 11
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC009942
• Gene Symbol: NUDT11
• Gene ID (NCBI): 55190
• RRID: AB_2153836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96G61
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NUDT11 (nucleoside diphosphate linked moiety X-type motif 11), also named as DIPP3B or APS1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Sci Rep; Construction of a diagnostic model utilizing m7G regulatory factors for the characterization of diabetic nephropathy and the immune microenvironment; Authors - Jingying Zhong