NUDT22 Monoclonal antibody

• 

  WB analysis using 67921-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67921-1-Ig (NUDT22 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 67921-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67921-1-Ig (NUDT22 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of Jurkat using 67921-1-Ig

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human NUDT22 (67921-1-Ig, Clone:3C3H9) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

NUDT22 Monoclonal Antibody for WB, ELISA, FC (Intra)

Cat No. 67921-1-Ig

Clone No.3C3H9

Host / Isotype

Mouse / IgG2b

Reactivity

Human, rat

Applications

WB, ELISA, FC (Intra)

Synonyms

UDPG pyrophosphatase, PP11246, NUDT 22, Nucleoside diphosphate-linked moiety X motif 22, EC:3.6.1.45

---

Tested Applications

• Positive WB detected in: Jurkat cells, LNCaP cells, K-562 cells, HSC-T6 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67921-1-Ig targets NUDT22 in WB, ELISA, FC (Intra) applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14787

  Product name: Recombinant human NUDT22 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-303 aa of BC006129

  Sequence: MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALLPPL

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 22
• Calculated Molecular Weight: 303 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC006129
• Gene Symbol: NUDT22
• Gene ID (NCBI): 84304
• RRID: AB_2918673
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRQ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human NUDT22 belongs to the diverse NUDIX family of proteins, is a Mg2+-dependent UDP-glucose and UDP-galactose hydrolase, producing UMP and glucose 1-phosphate or galactose 1-phosphate.