NUFIP1 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 12515-1-AP (same clone as 12515-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12515-1-AP (NUFIP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 12515-1-AP (same clone as 12515-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12515-1-AP (NUFIP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12515-1-AP (same clone as 12515-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12515-1-AP (NUFIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12515-1-AP (same clone as 12515-1-PBS)

  IP result of anti-NUFIP1 (IP:12515-1-AP, 4ug; Detection:12515-1-AP 1:800) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 12515-1-AP (same clone as 12515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12515-1-AP (NUFIP1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 12515-1-AP (same clone as 12515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 12515-1-AP (NUFIP1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12515-1-AP (same clone as 12515-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NUFIP1 antibody (12515-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12515-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NUFIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12515-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12515-1-PBS targets NUFIP1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3197

  Product name: Recombinant human NUFIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC017745

  Sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV

• Full Name: nuclear fragile X mental retardation protein interacting protein 1
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC017745
• Gene Symbol: NUFIP1
• Gene ID (NCBI): 26747
• RRID: AB_2298759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fragile X syndrome, the most common cause of inherited mental retardation, is caused by the absence of FMRP (Fragile X Mental Retardation Protein). FMRP is an RNA binding protein reported to be involved in translational control, notably at postsynaptic sites of protein synthesis as a part of a multiprotein/mRNA complex[PMID:12941608]. NUFIP1 is one of the several FMRP-interacting proteins. NUFIP can act as a pol II-specific basal transcriptional activator in vitro and when ectopically overexpressed in vivo. NUFIP can directly activate promoters by enhancing the ATP-dependent release of hyperphosphorylated form of pol II from open transcription complexes[PMID:15107825].