Tested Applications
| Positive WB detected in | HeLa cells, A375 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12515-1-AP targets NUFIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3197 Product name: Recombinant human NUFIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC017745 Sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV Predict reactive species |
| Full Name | nuclear fragile X mental retardation protein interacting protein 1 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC017745 |
| Gene Symbol | NUFIP1 |
| Gene ID (NCBI) | 26747 |
| RRID | AB_2298759 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHK0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fragile X syndrome, the most common cause of inherited mental retardation, is caused by the absence of FMRP (Fragile X Mental Retardation Protein). FMRP is an RNA binding protein reported to be involved in translational control, notably at postsynaptic sites of protein synthesis as a part of a multiprotein/mRNA complex[PMID:12941608]. NUFIP1 is one of the several FMRP-interacting proteins. NUFIP can act as a pol II-specific basal transcriptional activator in vitro and when ectopically overexpressed in vivo. NUFIP can directly activate promoters by enhancing the ATP-dependent release of hyperphosphorylated form of pol II from open transcription complexes[PMID:15107825].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NUFIP1 antibody 12515-1-AP | Download protocol |
| IHC protocol for NUFIP1 antibody 12515-1-AP | Download protocol |
| IP protocol for NUFIP1 antibody 12515-1-AP | Download protocol |
| WB protocol for NUFIP1 antibody 12515-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NUFIP1 antibody (Cat# 12515-1-AP) has 19 total citations. These appear in high-impact journals including Nature, Science, Nature Communications, Autophagy, Nucleic Acids Research, Science Advances, Advanced Science, Journal of Cell Biology, FASEB Journal, Burns & Trauma, Neurobiology of Disease, Neurotoxicology, Apoptosis, Frontiers in Immunology, and Zool Res. Research fields span ribophagy, ribosome/translation regulation, snoRNP assembly, nucleolar protein dynamics, sepsis and immune function, neurotoxicity, cancer cachexia, and fibrosis.
| Species | Application | Title |
|---|---|---|
Nature Systematic quantitative analysis of ribosome inventory during nutrient stress.
| ||
Autophagy The autophagic protein LC3 translocates to the nucleus and localizes in the nucleolus associated to NUFIP1 in response to cyclic mechanical stress. | ||
Nat Commun Brucella effectors NyxA and NyxB target SENP3 to modulate the subcellular localisation of nucleolar proteins | ||
Nucleic Acids Res Protein Hit1, a novel box C/D snoRNP assembly factor, controls cellular concentration of the scaffolding protein Rsa1 by direct interaction. | ||
Nucleic Acids Res SECIS-binding protein 2 interacts with the SMN complex and the methylosome for selenoprotein mRNP assembly and translation. |
Reviews
What customers say
The single review rates this antibody 3 out of 5 for Western Blot at a 1:1000 dilution. The reviewer found it acceptable but noted multiple off-target bands, particularly in the nucleus. When performing immunofluorescence with knockout cells, significant nuclear signal persisted even in the KO cells, indicating the need for caution in interpretation. Testing was conducted on HEK293T, HEK293, and HCT116 cell lines. Overall, the antibody works but requires careful validation to distinguish specific from non-specific binding.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
H (Verified Customer) (04-06-2020) | This antibody is okay, but there are multiple off-target bands especially in the nucleus. I have performed immunofluorescence analysis using KO cells, and I found significant signal in the nucleus even in the KO cells, requiring caution.
 |
