NUP153 Polyclonal antibody, PBS Only

• 

  WB analysis of K-562 using 14189-1-AP (same clone as 14189-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14189-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14189-1-AP (same clone as 14189-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14189-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 14189-1-AP (same clone as 14189-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14189-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 14189-1-AP (same clone as 14189-1-PBS)

  IP result of anti-NUP153 (IP:14189-1-AP, 4ug; Detection:14189-1-AP 1:500) with K-562 cells lysate 3600ug. This data was developed using the same antibody clone with 14189-1-PBS in a different storage buffer formulation.

NUP153 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 14189-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

14189-1-PBS targets NUP153 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5519

  Product name: Recombinant human NUP153 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1475 aa of BC052965

  Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

• Full Name: nucleoporin 153kDa
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154 kDa
• GenBank Accession Number: BC052965
• Gene Symbol: NUP153
• Gene ID (NCBI): 9972
• RRID: AB_2154463
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49790
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984].