NUP153 Polyclonal antibody

• 

  WB analysis of K-562 using 14189-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14189-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 14189-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 14189-1-AP (NUP153 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14189-1-AP

  IP result of anti-NUP153 (IP:14189-1-AP, 4ug; Detection:14189-1-AP 1:500) with K-562 cells lysate 3600ug.

NUP153 Polyclonal Antibody for WB, IP, ELISA

Cat No. 14189-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IP, ELISA

Synonyms

153 kDa nucleoporin, HNUP153, N153, nucleoporin 153kDa, Nucleoporin Nup153, NUP153

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, A431 cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

14189-1-AP targets NUP153 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5519

  Product name: Recombinant human NUP153 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1475 aa of BC052965

  Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

• Full Name: nucleoporin 153kDa
• Calculated Molecular Weight: 154 kDa
• Observed Molecular Weight: 154 kDa
• GenBank Accession Number: BC052965
• Gene Symbol: NUP153
• Gene ID (NCBI): 9972
• RRID: AB_2154463
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49790
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biotechnol J; Highly efficient identification of nucleocytoplasmic O-glycosylation by the TurboID-based proximity labeling method in living cells; Authors - Yunfeng Long
pig	WB	Int J Biol Macromol; Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection; Authors - Mingyang Li
Mouse		Nat Commun; BOOST: a robust ten-fold expansion method on hour-scale; Authors - Jinyu Guo
human	WB	J Med Virol; Novel Function of NUP153 in HNF4α Transcriptional Upregulation Contributes to Promoting HBV Replication; Authors - Qianqian Jiang