Tested Applications
| Positive WB detected in | K-562 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15538-1-AP targets NTF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7879 Product name: Recombinant human NUTF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-127 aa of BC002348 Sequence: GSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG Predict reactive species |
| Full Name | nuclear transport factor 2 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC002348 |
| Gene Symbol | NTF2 |
| Gene ID (NCBI) | 10204 |
| RRID | AB_2157805 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61970 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NUTF2 (nuclear transport factor 2), also named as NTF2, is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and/or threonine kinase-dependent signal transduction mechanism(s) (PMID: 22880006). The MW of this protein is 14 kDa, and this antibody specially recognises the 14 kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NTF2 antibody 15538-1-AP | Download protocol |
| IHC protocol for NTF2 antibody 15538-1-AP | Download protocol |
| WB protocol for NTF2 antibody 15538-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Lab Invest Nup210 Promotes Colorectal Cancer Progression by Regulating Nuclear Plasma Transport | ||
Oral Dis NUTF2 Promotes Proliferation of Oral Squamous Cell Carcinoma Through PI3K/AKT Signaling Pathway
|







