Published Applications
| IHC | See 1 publications below |
Product Information
13809-1-AP targets NXPH1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4814 Product name: Recombinant human NXPH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC047505 Sequence: MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPR Predict reactive species |
| Full Name | neurexophilin 1 |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| GenBank Accession Number | BC047505 |
| Gene Symbol | NXPH1 |
| Gene ID (NCBI) | 30010 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58417 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neurexophilins (NXPH) are a family of neuropeptide-like secreted glycoproteins expressed in specific regions of the brain. Neurexophilin1 (NXPH1) is a secreted protein with a variable N-terminal domain, a highly conserved, N-glycosylated central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein forms a very tight complex with alpha neurexins, a group of proteins that promote adhesion between dendrites and axons. Northern blot analysis of a variety of human tissues detected NXPH1 expression in spleen; unlike NXPH2 to NXPH4, NXPH1 expression was not observed in brain.
