Tested Applications
Positive WB detected in | mouse kidney tissue, mouse lung tissue, rat kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26783-1-AP targets NaPi-IIa in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24807 Product name: Recombinant human SLC34A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC053349 Sequence: MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLK Predict reactive species |
Full Name | solute carrier family 34 (sodium phosphate), member 1 |
Observed Molecular Weight | 70-75 kDa, 30-35 kDa |
GenBank Accession Number | BC053349 |
Gene Symbol | SLC34A1 |
Gene ID (NCBI) | 6569 |
RRID | AB_3085903 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q06495 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NaPi-IIa, also known as Npt2a (SLC34A1), is an electrogenic Na+-dependent Pi cotransporter expressed in the brush border membranes (BBM) of renal proximal tubules. NaPi-IIa could be detected with an apparent molecular weight 75 kDa, corresponding to the full length glycosylated protein, together with a lower molecular weight 37 kDa known to be a N-terminal proteolytic fragment which is also glycosylated (PMID:36074191).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NaPi-IIa antibody 26783-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |