Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse lung tissue, rat kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26783-1-AP targets NaPi-IIa in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24807 Product name: Recombinant human SLC34A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC053349 Sequence: MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLK Predict reactive species |
| Full Name | solute carrier family 34 (sodium phosphate), member 1 |
| Observed Molecular Weight | 70-75 kDa, 30-35 kDa |
| GenBank Accession Number | BC053349 |
| Gene Symbol | SLC34A1 |
| Gene ID (NCBI) | 6569 |
| RRID | AB_3085903 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06495 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NaPi-IIa, also known as Npt2a (SLC34A1), is an electrogenic Na+-dependent Pi cotransporter expressed in the brush border membranes (BBM) of renal proximal tubules. NaPi-IIa could be detected with an apparent molecular weight 75 kDa, corresponding to the full length glycosylated protein, together with a lower molecular weight 37 kDa known to be a N-terminal proteolytic fragment which is also glycosylated (PMID:36074191).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NaPi-IIa antibody 26783-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

