CoraLite®555-conjugated NeuN Polyclonal antibody

• 

  IF Staining of mouse brain using CL555-26975

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite®555 NeuN antibody (CL555-26975) at dilution of 1:200.

• 

  FC experiment of U-87 MG using CL555-26975

  1X10^6 U-87 MG cells were intracellularly stained with 0.8 ug CoraLite®555 Anti-Human NeuN (CL555-26975) (red), or 0.8 ug Isotype Control. Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. CL555-26975

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF-P, FC (Intra)

Synonyms

cDNA FLJ56884, FLJ56884, FLJ58356, FOX3, hCG_1776007, Homo sapiens (Human), HRNBP3, NeuN, RBFOX3

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue
• Positive FC (Intra) detected in: U-87 MG cells
• Positive FC detected in: U-87 MG cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-26975 targets NeuN in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25689

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• Observed Molecular Weight: 46-52 kDa
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_2919647
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Function

NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).

Tissue specificity

NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).

Involvement in disease

· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).

Isoforms

There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).

Post-translational modifications

Currently not known.

Cellular localization

NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).