Tested Applications
| Positive WB detected in | fetal human brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
27087-1-AP targets Neurocan in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25821 Product name: Recombinant human Neurocan protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 451-550 aa of NM_004386 Sequence: MVAPSPSDMGAGTAASSHTEVAPTDPMPRRRGRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSPWADLTNEVDM Predict reactive species |
| Full Name | neurocan |
| Calculated Molecular Weight | 143 kDa |
| Observed Molecular Weight | 270 kDa |
| GenBank Accession Number | NM_004386 |
| Gene Symbol | Neurocan |
| Gene ID (NCBI) | 1463 |
| RRID | AB_2880751 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14594 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Neurocan antibody 27087-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Echinacoside targets the HIF-1α/LDHA axis to modulate A1/A2 astrocyte differentiation and promote glial scar repair following ischemic stroke | ||

