Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HEK-293T cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse brain tissue, human liver tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
27249-1-AP targets Neurofibromin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species |
| Full Name | neurofibromin 1 |
| Calculated Molecular Weight | 319 kDa |
| Observed Molecular Weight | 250-280 kDa |
| GenBank Accession Number | M60915 |
| Gene Symbol | Neurofibromin 1 |
| Gene ID (NCBI) | 4763 |
| RRID | AB_2880818 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21359 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neurofibromin 1 antibody 27249-1-AP | Download protocol |
| IHC protocol for Neurofibromin 1 antibody 27249-1-AP | Download protocol |
| IP protocol for Neurofibromin 1 antibody 27249-1-AP | Download protocol |
| WB protocol for Neurofibromin 1 antibody 27249-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Targeting NRAS via miR-1304-5p or farnesyltransferase inhibition confers sensitivity to ALK inhibitors in ALK-mutant neuroblastoma | ||
Clin Transl Med IGF2BP3 mediates the mRNA degradation of NF1 to promote triple-negative breast cancer progression via an m6A-dependent manner | ||
Gynecol Oncol Survey of NF1 inactivation by surrogate immunohistochemistry in ovarian carcinomas | ||
Front Genet Characterization of Two Loss-of-Function NF1 Variants in Chinese Patients and Potential Molecular Interpretations of Phenotypes. | ||
Mol Genet Genomic Med A novel mutation in NF1 gene of patient with Neurofibromatosis type 1: A case report and functional study. | ||
J Transl Med The oncogenic role of NF1 in gallbladder cancer through regulation of YAP1 stability by direct interaction with YAP1
|



















