Noggin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84283-5-RR (same clone as 84283-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84283-5-RR (NOG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84283-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 84283-5-RR (same clone as 84283-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84283-5-RR (Noggin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84283-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84283-5-RR (same clone as 84283-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84283-5-RR (Noggin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84283-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84283-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84283-5-RR against Human Noggin were performed. The affinity constant is below 1 pM.

Noggin Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84283-5-PBS

Clone No.241511D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

NOG, 241511D10, SYM1, SYNS1

---

Product Information

84283-5-PBS targets Noggin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32755

  Product name: Recombinant human NOG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-145 aa of BC034027

  Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL

• Full Name: noggin
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC034027
• Gene Symbol: Noggin
• Gene ID (NCBI): 9241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13253
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14. Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with heparin sulfate proteoglycans. In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles.