Product Information
84283-5-PBS targets Noggin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32755 Product name: Recombinant human NOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-145 aa of BC034027 Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL Predict reactive species |
| Full Name | noggin |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC034027 |
| Gene Symbol | Noggin |
| Gene ID (NCBI) | 9241 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q13253 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14. Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with heparin sulfate proteoglycans. In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles.







