Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 28 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
26574-1-AP targets OAT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24234 Product name: Recombinant human SLC22A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-550 aa of BC033682 Sequence: SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL Predict reactive species |
| Full Name | solute carrier family 22 (organic anion transporter), member 6 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 60-65 and 70-80 kDa |
| GenBank Accession Number | BC033682 |
| Gene Symbol | OAT1 |
| Gene ID (NCBI) | 9356 |
| RRID | AB_2880557 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4U2R8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OAT1, also named as SLC22A6, has two GXXXG motifs in its transmembrane which is associated with protein processing and oligomerization of other proteins. OAT1 is involved in the renal elimination of endogenous and exogenous organic anions. It has been reported that OAT1 plays a key role in clearing endogenous metabolites, toxins and drugs from blood. OAT1 has some isoforms and the calculated MW ranges from 55 kDa to 62 kDa. 26574-1-AP antibody detects the 60-65 kDa (native forms) and 70-80 kDa (mature forms) protein in SDS-PAGE. (PMID: 21340049, 23389457, 23196129)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for OAT1 antibody 26574-1-AP | Download protocol |
| WB protocol for OAT1 antibody 26574-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Amelioration effects of α-viniferin on hyperuricemia and hyperuricemia-induced kidney injury in mice | ||
Phytomedicine The inhibitory effect of Astragalus flavone extract on hyperuricemia and its underlying molecular mechanism by targeting JNK/AP-1/NLRP3/IL-1β signaling pathway | ||
J Ethnopharmacol Simiao San alleviates hyperuricemia and kidney inflammation by inhibiting NLRP3 inflammasome and JAK2/STAT3 signaling in hyperuricemia mice | ||
J Ethnopharmacol Fuling-Zexie formula attenuates hyperuricemia-induced nephropathy and inhibits JAK2/STAT3 signaling and NLRP3 inflammasome activation in mice | ||
Front Microbiol Effect and mechanism of Plantaginis Semen polysaccharides on intestinal microecology in rats with hyperuricemia | ||
Am J Physiol Renal Physiol SGLT2 inhibitor dapagliflozin protects the kidney in a murine model of Balkan nephropathy |





