Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, NCCIT cells, MDA-MB-231 cells, mouse brain tissue, U-251 cells, rat brain tissue, mouse embryo tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 233 publications below |
| IHC | See 6 publications below |
| IP | See 1 publications below |
| FC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
11263-1-AP targets OCT4/POU5F1 in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1794 Product name: Recombinant human OCT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-265 aa of BC020712 Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Predict reactive species |
| Full Name | POU class 5 homeobox 1 |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 38 kDa, 50-60 kDa |
| GenBank Accession Number | BC020712 |
| Gene Symbol | POU5F1 |
| Gene ID (NCBI) | 5460 |
| RRID | AB_2167545 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01860 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Background
Octamer-binding protein 4 (OCT4), also known as POU5F1 or OCT3/4, is a member of the POU gene family and encoded by the human gene POU5F1 (POU domain class 5 transcription factor 1). OCT4 is a member of the Octamer class of transcription factors that recognize the 8-base pair consensus motif 5'-ATGCAAAT-3'. Expression of OCT4 is associated with an undifferentiated, pluripotent stem cell phenotype and tumors. OCT4 is also expressed in the developing brain, with the highest levels found in the cortex, olfactory bulb, and the hippocampus.
What is the molecular weight of OCT4?
The molecular weight of OCT4 is 38 kDa.
What are the isoforms of OCT4?
The human POU51F gene consists of five exons located on chromosome 6 and can generate three mRNA isoforms through alternative splicing - OCT4A, OCT4B, and OCT4B1 (PMID: 18787205). OCT4A and OCT4B1 orchestrate gene transcription in the nucleus supporting self-renewal and pluripotency maintenance in ESCs and embryonal carcinoma cells, whereas OCT4B is localized in the cytoplasm in various non-pluripotent cell types and cannot sustain self-renewal and pluripotency.
What is OCT4's involvement in pluripotency and self-renewal?
OCT4 forms a trimeric complex with SOX2 and DNA to control the expression of genes involved with embryonic development, such as FGF4 (PMID: 10801796), UTF1 (PMID: 10409735), or even NANOG (PMID: 15743839). OCT4 is critical for early embryogenesis (PMID: 9814708) and for embryonic stem cell pluripotency (PMID: 16153702). High levels of OCT4 are associated with the ability to self-renew, which is emphasized by OCT4 gene knockdowns promoting differentiation (PMID: 10742100). OCT4 is also one of the four key transcription factors used to generate induced pluripotent stem cells (iPSCs) by reprogramming fibroblasts to a pluripotent state (PMID: 16904174).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for OCT4/POU5F1 antibody 11263-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Temporal proteomics during neurogenesis reveals large-scale proteome and organelle remodeling via selective autophagy | ||
Cell Rep Med CD97 maintains tumorigenicity of glioblastoma stem cells via mTORC2 signaling and is targeted by CAR Th9 cells | ||
Bone Res Type II collagen-positive progenitors are important stem cells in controlling skeletal development and vascular formation. | ||
J Exp Clin Cancer Res Membrane RRM2-positive cells represent a malignant population with cancer stem cell features in intrahepatic cholangiocarcinoma | ||
J Control Release Dual-phase nanoscissors disrupt vasculature-breast cancer stem cell crosstalk for breast cancer treatment | ||
J Pineal Res Melatonin inhibits the stemness of head and neck squamous cell carcinoma by modulating HA synthesis via the FOSL1/HAS3 axis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Claudia (Verified Customer) (03-06-2026) | Clear band in mouse ESCs 1:2000 overnight incubation
|
FH Zhiping (Verified Customer) (06-21-2023) | This antibody works well for WB.
|
FH Udesh (Verified Customer) (11-18-2022) | Worked well in Osteosarcoma U2OS cells. 20ug protein loaded. Dilution 1:2000 in 5% NFDM.
![]() |
FH Gongsheng (Verified Customer) (11-02-2022) | This antibody works well in WB, diluation 1:1000, incubation at +4 °C.
|
FH Silvia (Verified Customer) (10-19-2021) | It works well for Immunofluorescence on hiPSCs
|










