OCT4/POU5F1 Monoclonal antibody, PBS Only

OCT4/POU5F1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60242-1-PBS
Clone No.1C4B6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

OCT4, POU5F1, 1C4B6, OCT3, Oct-3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60242-1-PBS targets OCT4/POU5F1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1794

Product name: Recombinant human OCT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 102-265 aa of BC020712

Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Predict reactive species
Full Name POU class 5 homeobox 1
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 50-52 kDa
GenBank Accession NumberBC020712
Gene Symbol POU5F1
Gene ID (NCBI) 5460
RRIDAB_2881364
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01860
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Background

Octamer-binding protein 4 (OCT4), also known as POU5F1 or OCT3/4, is a member of the POU gene family and encoded by the human gene POU5F1 (POU domain class 5 transcription factor 1). OCT4 is a member of the Octamer class of transcription factors that recognize the 8-base pair consensus motif 5'-ATGCAAAT-3'. Expression of OCT4 is associated with an undifferentiated, pluripotent stem cell phenotype and tumors. OCT4 is also expressed in the developing brain, with the highest levels found in the cortex, olfactory bulb, and the hippocampus.

 What is the molecular weight of OCT4?

The molecular weight of OCT4 is 38 kDa.

 What are the isoforms of OCT4?

The human POU51F gene consists of five exons located on chromosome 6 and can generate three mRNA isoforms through alternative splicing - OCT4A, OCT4B, and OCT4B1 (PMID: 18787205). OCT4A and OCT4B1 orchestrate gene transcription in the nucleus supporting self-renewal and pluripotency maintenance in ESCs and embryonal carcinoma cells, whereas OCT4B is localized in the cytoplasm in various non-pluripotent cell types and cannot sustain self-renewal and pluripotency.

 What is OCT4's involvement in pluripotency and self-renewal?

OCT4 forms a trimeric complex with SOX2 and DNA to control the expression of genes involved with embryonic development, such as FGF4 (PMID: 10801796), UTF1 (PMID: 10409735), or even NANOG (PMID: 15743839). OCT4 is critical for early embryogenesis (PMID: 9814708) and for embryonic stem cell pluripotency (PMID: 16153702). High levels of OCT4 are associated with the ability to self-renew, which is emphasized by OCT4 gene knockdowns promoting differentiation (PMID: 10742100). OCT4 is also one of the four key transcription factors used to generate induced pluripotent stem cells (iPSCs) by reprogramming fibroblasts to a pluripotent state (PMID: 16904174).



Loading...
||
New chat Able
正在加载,请稍候...