OFD1 Polyclonal antibody

OFD1 Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 22851-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA

71 7A, Centriole and centriolar satellite protein OFD1, CXorf5, Oral-facial-digital syndrome 1 protein, Protein 71 7A

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells, hTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22851-1-AP targets OFD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18898

Product name: Recombinant human OFD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-305 aa of BC096344

Sequence: MMAQSNMFTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSSLLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVSGSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQRIKFESLEIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQ

Predict reactive species
Full Name oral-facial-digital syndrome 1
Calculated Molecular Weight 1012 aa, 117 kDa
Observed Molecular Weight 110-120 kDa
GenBank Accession NumberBC096344
Gene Symbol OFD1
Gene ID (NCBI) 8481
RRIDAB_2879177
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75665
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OFD1, also named CXorf5 and 71-7A, belongs to the OFD1 family. It has been implicated in several developmental syndromes, including a male-lethal X-linked dominant condition, Oral-Facial-Digital type 1 (OFD1) syndrome, X-linked recessiveSimpson-Golabi-Behmel syndrome type 2 (SGBS2), and Joubert syndrome and related disorders (JSRDs). It is a component of the centrioles controlling mother and daughter centrioles' length. It recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164. Involved in the biogenesis of the cilium, a centriole-associated function. OFD1 plays an important role in development by regulating Wnt signaling and the specification of the left-right axis. This antibody recognizes all the isoforms of OFD1. The 43 kDa is isoform 2. The ~80 kDa band is unknown.

Protocols

Product Specific Protocols
IHC protocol for OFD1 antibody 22851-1-APDownload protocol
IF protocol for OFD1 antibody 22851-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Commun

Coupling bimolecular PARylation biosensors with genetic screens to identify PARylation targets.

Authors - Dragomir B Krastev
humanIF

PLoS Biol

Acute inhibition of centriolar satellite function and positioning reveals their functions at the primary cilium.

Authors - Özge Z Aydin
ratWB

Biochem Biophys Res Commun

BIX-01294-induced autophagy regulates elongation of primary cilia.

Authors - Ji Hyun Shin
humanWB,IF

Oncol Lett

Abnormal accumulation of OFD1 in endometrial cancer with poor prognosis inhibits ciliogenesis.

Authors - Ryuji Kojima
human,mouseWB

Cell Death Dis

PMID: 31844040

Authors - Ji-Eun Bae
zebrafishWB

Cell Biosci

IK is essentially involved in ciliogenesis as an upstream regulator of oral-facial-digital syndrome ciliopathy gene, ofd1

Authors - Hye In Ka

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Elisa (Verified Customer) (06-15-2022)

HEK293 cells stained for Hoechst (DNA marker, in green), OFD1 (mother centriole distal appendage marker, in magenta) and PCNT (pericentriolar matrix marker, in green). HEK293 cells were plated on Poly-lysine coated coverslips and fixed in cold methanol for 2' at -20C. Cells were then rehydrated with PBS for 5'. Membrane permeabilization was then performed with 0.1% Triton + 0.1% Tween +0.01%SDS in PBS for 5'. Cells were finally incubated with blocking buffer (5% BSA+ 0.1% Tween in PBS) for 30' at RT. Primary antibody was diluted in blocking buffer 1:200 and incubated for 1h at room temperature. Alexa-555-Anti-rabbit was used as secondary antibody (1:600 dilution) (1h at room temperature). OFD1 recognises mother centriole.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: HEK293 cells (Human embryonic kidney 293 cells)
OFD1 Antibody Immunofluorescence validation (1:300 dilution) in HEK293 cells (Human embryonic kidney 293 cells) (Cat no:22851-1-AP)
FH

Sarah (Verified Customer) (02-16-2021)

Works very well for detection of OFD1 in HEK 293T cells

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: HEK 293T
OFD1 Antibody Immunofluorescence validation (1:300 dilution) in HEK 293T (Cat no:22851-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...