OGFOD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 30800-1-AP (same clone as 30800-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30800-1-AP (OGFOD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30800-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 30800-1-AP (same clone as 30800-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 30800-1-AP (OGFOD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30800-1-PBS in a different storage buffer formulation.

OGFOD1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1, EC:1.14.11.-, KIAA1612, OGFOD 1, Prolyl 3-hydroxylase OGFOD1

---

Product Information

30800-1-PBS targets OGFOD1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34034

  Product name: Recombinant human OGFOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-542 aa of BC032919

  Sequence: PKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE

• Full Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 1
• Calculated Molecular Weight: 542 aa, 63 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC032919
• Gene Symbol: OGFOD1
• Gene ID (NCBI): 55239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N543
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1 (OGFOD1) is a proly hydroxylase which belongs to 2-OG-Fe (II) dioxygenase family, it also namely KIAA1612 and TPA1. OGFOD1 is expressed in many tissues, mainly located in the nucleoplasm. It increased in many cancers and regulates both transcription and translation. The apparent molecular weight is larger than the calculated molecular weight of 63 kDa, which is likely due to posttranslational modification, presumably by glycosylation. (PMID:34298635 and 20579638)