OPA3 Polyclonal antibody

• 

  WB analysis using 15638-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15638-1-AP (OPA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15638-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15638-1-AP (OPA3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 15638-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 15638-1-AP (OPA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 15638-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15638-1-AP (OPA3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 15638-1-AP

  IP result of anti-OPA3 (IP:15638-1-AP, 4ug; Detection:15638-1-AP 1:1000) with HeLa cells lysate 1240 ug.

• 

  IHC staining of human liver using 15638-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15638-1-AP (OPA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 15638-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15638-1-AP (OPA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 15638-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15638-1-AP (OPA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 15638-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15638-1-AP (OPA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 15638-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using OPA3 antibody (15638-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

OPA3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15638-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Optic atrophy 3 protein, MGA3

---

Tested Applications

• Positive WB detected in: A549 cells, human kidney tissue, mouse thymus tissue, Jurkat cells, HeLa cells, HEK-293T cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 3 publications below
• IP: See 1 publications below

Product Information

15638-1-AP targets OPA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8103

  Product name: Recombinant human OPA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-179 aa of BC005059

  Sequence: ANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

• Full Name: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
• Calculated Molecular Weight: 179 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005059
• Gene Symbol: OPA3
• Gene ID (NCBI): 80207
• RRID: AB_2158168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6K4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The OPA3 cDNA encodes a deduced 179-amino acid protein. Northern blot analysis demonstrated a primary transcript of approximately 5.0 kb that was ubiquitously expressed, most prominently in skeletal muscle and kidney. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Hum Mol Genet; Disrupted mitochondrial function in the Opa3L122P mouse model for Costeff Syndrome impairs skeletal integrity.; Authors - Alice E Navein
mouse,rat	WB,IP	Cell Signal; Hydrogen sulfide alleviates mitochondrial damage and ferroptosis by regulating OPA3-NFS1 axis in doxorubicin-induced cardiotoxicity; Authors - Yifan Wang
human,mouse	WB,IHC	Invest Ophthalmol Vis Sci; Mitochondrial localization and ocular expression of mutant Opa3 in a mouse model of 3-methylglutaconicaciduria type III.; Authors - Powell Kate A KA
bovine	WB	Genomics; A nonsense mutation in the optic atrophy 3 gene (OPA3) causes dilated cardiomyopathy in Red Holstein cattle.; Authors - Owczarek-Lipska Marta M
human	WB	Bioengineered; MYB proto-oncogene like 2 promotes hepatocellular carcinoma growth and glycolysis via binding to the Optic atrophy 3 promoter and activating its expression.; Authors - Miao Liu ; KD Validated
human	IHC	Cancers (Basel); Oncogenic K-ras Induces Mitochondrial OPA3 Expression to Promote Energy Metabolism in Pancreatic Cancer Cells.; Authors - Ning Meng