Tested Applications
Positive WB detected in | HeLa cells, mouse brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human cerebellum tissue, human retinoblastoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 2 publications below |
Product Information
11076-1-AP targets Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1536 Product name: Recombinant human OPHN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-722 aa of BC059393 Sequence: DSSQCASIPYNGQGYPEPYVPEGGAYLPDREPFIVPVEPERTAEYEDDYGADEPEQQHPDHRRWRRALRPGPG Predict reactive species |
Full Name | oligophrenin 1 |
Calculated Molecular Weight | 802 aa, 92 kDa |
Observed Molecular Weight | 92 kDa |
GenBank Accession Number | BC059393 |
Gene Symbol | Oligophrenin 1 |
Gene ID (NCBI) | 4983 |
RRID | AB_2158306 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60890 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The OPHN1 gene encodes a Rho-GTPase activating protein (RhoGAP), and mutations in OPHN1 are responsible for non-specific X-linked mental retardation (NSMR). OPHN1 is highly expressed in the brain and present both pre- and postsynaptically in neurons.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
IHC protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
IF protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
IP protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Ann Surg Oncol Additive lymph node dissection may be necessary in minute submucosal cancer of the stomach after endoscopic resection. | ||
PLoS One Oligophrenin-1 (OPHN1), a gene involved in X-linked intellectual disability, undergoes RNA editing and alternative splicing during human brain development. | ||
Neurosci Lett Alpha lipoic acid treatment in late middle age improves cognitive function: Proteomic analysis of the protective mechanisms in the hippocampus |