Tested Applications
| Positive WB detected in | fetal human brain tissue, HeLa cells, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11076-1-AP targets Oligophrenin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1536 Product name: Recombinant human OPHN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-722 aa of BC059393 Sequence: DSSQCASIPYNGQGYPEPYVPEGGAYLPDREPFIVPVEPERTAEYEDDYGADEPEQQHPDHRRWRRALRPGPG Predict reactive species |
| Full Name | oligophrenin 1 |
| Calculated Molecular Weight | 802 aa, 92 kDa |
| Observed Molecular Weight | 92 kDa |
| GenBank Accession Number | BC059393 |
| Gene Symbol | Oligophrenin 1 |
| Gene ID (NCBI) | 4983 |
| RRID | AB_2158306 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60890 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The OPHN1 gene encodes a Rho-GTPase activating protein (RhoGAP), and mutations in OPHN1 are responsible for non-specific X-linked mental retardation (NSMR). OPHN1 is highly expressed in the brain and present both pre- and postsynaptically in neurons.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
| IHC protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
| IP protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
| WB protocol for Oligophrenin 1 antibody 11076-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Ann Surg Oncol Additive lymph node dissection may be necessary in minute submucosal cancer of the stomach after endoscopic resection. | ||
PLoS One Oligophrenin-1 (OPHN1), a gene involved in X-linked intellectual disability, undergoes RNA editing and alternative splicing during human brain development. | ||
Neurosci Lett Alpha lipoic acid treatment in late middle age improves cognitive function: Proteomic analysis of the protective mechanisms in the hippocampus |











