Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
30975-1-AP targets OPN1MW in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34169 Product name: Recombinant human OPN1MW protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC156776 Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV Predict reactive species |
| Full Name | opsin 1 (cone pigments), medium-wave-sensitive |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC156776 |
| Gene Symbol | OPN1MW |
| Gene ID (NCBI) | 2652 |
| RRID | AB_3669801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P04001 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OPN1MW (opsin 1, medium wave sensitive), also known as CBD. It is expected to be located in cell membrane. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness. The calculated molecular weight of OPN1MW is 40 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for OPN1MW antibody 30975-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Christoffer (Verified Customer) (02-19-2025) | The antibody works well on both cryosections and paraffin-embedded tissues. However, for optimal results, antigen retrieval is recommended for cryosections as well. Citrate buffer antigen retrieval method was used.
|

