OPN4 Polyclonal antibody

• 

  IF Staining of mouse eye using 24478-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN4 antibody (24478-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

OPN4 Polyclonal Antibody for IF-P, ELISA

Cat No. 24478-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, ELISA

Synonyms

Opsin-4, opsin 4, MOP, Melanopsin

---

Tested Applications

• Positive IF-P detected in: mouse eye tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24478-1-AP targets OPN4 in IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21643

  Product name: Recombinant human OPN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 356-478 aa of BC113558

  Sequence: KYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM

• Full Name: opsin 4
• Calculated Molecular Weight: 478 aa, 53 kDa
• GenBank Accession Number: BC113558
• Gene Symbol: OPN4
• Gene ID (NCBI): 94233
• RRID: AB_3085736
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHM6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OPN4, an opsin that was first isolated from the skin of Xenopus laevis in 1998, belongs not to the vertebrate-type opsin family but rather to the invertebrate-type opsins, which are part of the seven-transmembrane G protein-coupled receptor (GPCR) family (PMID:31989708). In humans, OPN4 is expressed in the retinal ganglion cells in addition to part of the brain (PMID:10632589). Moreover, Opn4 functions as a photoreceptor by detecting brightness levels and discriminating visual signals (PMID:22633808). Opn4 also facilitates visual circuits to acquire optimal settings and light adaptation by measuring irradiance levels (PMID:25517373).