Tested Applications
| Positive WB detected in | SK-N-SH cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28887-1-AP targets OPRM1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30275 Product name: Recombinant human OPRM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC074927 Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI Predict reactive species |
| Full Name | opioid receptor, mu 1 |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC074927 |
| Gene Symbol | OPRM1 |
| Gene ID (NCBI) | 4988 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35372 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OPRM1 (also known as Mu opioid receptor, MOR1, MOP) is a G protein-coupled receptor that mediates the physiological effects of endogenous opioids as well as the structurally distinct opioid alkaloids including morphine and etorphine (PMID: 9618555). Mu opioid receptor modulates a wide range of physiological functions, particularly involved in the control of pain perception and reward properties (PMID: 30483121). Mu opioid receptor is the principal target of opioid drugs. It is encoded by OPRM1 gene and multiple transcript variants encoding different isoforms have been found. Mu opioid receptor contains sites for N-linked glycosylation. The transcript variants and variations of glycosylation may result in migrating bands of Mu opioid receptor (PMID: 21886594; 11359768).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for OPRM1 antibody 28887-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

