ORAI3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ORAI3 Polyclonal antibody (25766-1-AP)

ORAI3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25766-1-AP Copied!

Publications (11)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Protein orai-3, TMEM142C, Transmembrane protein 142C

• 

  WB analysis of mouse heart using 25766-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25766-1-AP (ORAI3 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25766-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25766-1-AP (ORAI3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 25766-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25766-1-AP (ORAI3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ORAI3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, BxPC-3 cells, LNCaP cells, PC-3 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25766-1-AP targets ORAI3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22513

  Product name: Recombinant human ORAI3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of BC006126

  Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA

• Full Name: ORAI calcium release-activated calcium modulator 3
• Calculated Molecular Weight: 295 aa, 32 kDa
• Observed Molecular Weight: ~30 kDa, 60 kDa
• GenBank Accession Number: BC006126
• Gene Symbol: ORAI3
• Gene ID (NCBI): 93129
• RRID: AB_2880231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRQ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).

Publications

What published studies show

The ORAI3 Polyclonal antibody (Cat# 25766-1-AP) has 11 citations published in journals including Advanced Science, Journal of Orthopaedic Translation, Stem Cell Research & Therapy, Science Signaling, Cell & Molecular Life Sciences, BMJ Open Diabetes Research & Care, Allergy, Asthma & Immunology Research, Experimental & Therapeutic Medicine, Journal of Obstetrics and Gynaecology Research, and Life Sciences. Research fields span prostate cancer, breast cancer, cervical cancer, rheumatoid arthritis, diabetes-related endothelial biology, asthma, lung cancer, vascular biology, and atrial fibrillation.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); Single-Cell Dissection of Therapy-Induced Remodeling Uncovers a Fibroblast-Driven Immunosuppressive Niche and Targetable Vulnerabilities in Lethal Prostate Cancer.; Authors - Yang Chen
mouse	IF	J Orthop Translat; Tibial cortex transverse transport regulates Orai1/STIM1-mediated NO release and improve the migration and proliferation of vessels via increasing osteopontin expression; Authors - Lingchao Kong
human	IHC	Stem Cell Res Ther; Orai1 and Orai3 act through distinct signalling axes to promote stemness and tumorigenicity of breast cancer stem cells; Authors - Duan Zhuo
human	WB	Sci Signal; ALOX5 drives the pyroptosis of CD4+ T cells and tissue inflammation in rheumatoid arthritis; Authors - Hao Cai
human, mouse	WB,IHC	Cell Mol Life Sci; Hypoxia drives cervical cancer progression via OCT4/ORAI3-dependent glycolysis and Ca(2+) signaling.; Authors - Lingjia Lu ; KD Validated
mouse	IP	BMJ Open Diabetes Res Care; Orai-vascular endothelial-cadherin signaling complex regulates high-glucose exposure-induced increased permeability of mouse aortic endothelial cells.; Authors - Yuan Wei

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Able is busy answering your previous question. Please try again later.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

David (Verified Customer) (02-06-2023)

Works pretty well for our WB

• Applications: Western Blot