OSBPL6 Polyclonal antibody

• 

  WB analysis using 32158-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32158-1-AP (OSBPL6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 32158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 32158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 32158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 32158-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OSBPL6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32158-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ORP6, ORP-6, OSBP-related protein 6, Oxysterol-binding protein-related protein 6

---

Tested Applications

• Positive WB detected in: HEL cells
• Positive IHC detected in: mouse skeletal muscle tissue, mouse brain tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32158-1-AP targets OSBPL6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37534

  Product name: Recombinant human OSBPL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 189-308 aa of BC052259

  Sequence: RSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQVPFSATMSPV

• Full Name: oxysterol binding protein-like 6
• Calculated Molecular Weight: 934 aa, 106 kDa
• Observed Molecular Weight: 106 kDa
• GenBank Accession Number: BC052259
• Gene Symbol: OSBPL6
• Gene ID (NCBI): 114880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BZF3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.