Tested Applications
| Positive WB detected in | mouse small intestine tissue, rat small intestine tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
31330-1-AP targets OSTA in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34517 Product name: Recombinant human SLC51A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-48 aa of NM_152672 Sequence: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP Predict reactive species |
| Full Name | organic solute transporter alpha |
| Calculated Molecular Weight | 340 aa, 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | NM_152672 |
| Gene Symbol | SLC51A |
| Gene ID (NCBI) | 200931 |
| RRID | AB_3669946 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q86UW1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC51A also known as OSTA, belongs to the OST-alpha family. SLC51A is an essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). SLC51A is located in basolateral plasma membrane and transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B. SLC51A is expressed with a high expression in kidney and intestine (PMID: 15563450). Mutations in SLC51A are associated with Cholestasis progressive familial intrahepatic 6(PMID: 31863603).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for OSTA antibody 31330-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Cortex Dictamni induces cholestatic liver injury via the bile acid-gut-liver axis mediated by FXR signaling pathway in rats | ||
J Ethnopharmacol Sub-chronic realgar exposure causes liver inflammatory injury in mice by inducing bile acid-mediated NLRP3 inflammasome activation through down-regulation of ileal FXR |
