OSTA Polyclonal antibody

• 

  WB analysis using 31330-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31330-1-AP (SLC51A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

OSTA Polyclonal Antibody for WB, ELISA

Cat No. 31330-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

SLC51A, OSTalpha, OST alpha

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue, rat small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31330-1-AP targets OSTA in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34517

  Product name: Recombinant human SLC51A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-48 aa of NM_152672

  Sequence: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP

• Full Name: organic solute transporter alpha
• Calculated Molecular Weight: 340 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_152672
• Gene Symbol: SLC51A
• Gene ID (NCBI): 200931
• RRID: AB_3669946
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC51A also known as OSTA, belongs to the OST-alpha family. SLC51A is an essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). SLC51A is located in basolateral plasma membrane and transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B. SLC51A is expressed with a high expression in kidney and intestine (PMID: 15563450). Mutations in SLC51A are associated with Cholestasis progressive familial intrahepatic 6(PMID: 31863603).