Product Information
82794-3-PBS targets OX40L/TNFSF4 as part of a matched antibody pair:
MP00327-3: 82794-5-PBS capture and 82794-3-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0582 Product name: Recombinant Human OX40L/TNFSF4 protein (His Tag) Source: mammalian cells-derived, pCDNA3.4-IGSF8(C6) Tag: N-6*His Domain: 51-183 aa of NM_003326.5 Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 4 |
| GenBank Accession Number | NM_003326.5 |
| Gene Symbol | OX40L/TNFSF4 |
| Gene ID (NCBI) | 7292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23510 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





