Tested Applications
| Positive WB detected in | HUVEC cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MJ cells |
| Positive FC detected in | MJ cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82794-7-RR targets OX40L/TNFSF4 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0582 Product name: Recombinant Human OX40L/TNFSF4 protein (His Tag) Source: mammalian cells-derived, pCDNA3.4-IGSF8(C6) Tag: N-6*His Domain: 51-183 aa of NM_003326.5 Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 4 |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | NM_003326.5 |
| Gene Symbol | OX40L/TNFSF4 |
| Gene ID (NCBI) | 7292 |
| RRID | AB_3670552 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P23510 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for OX40L/TNFSF4 antibody 82794-7-RR | Download protocol |
| IF protocol for OX40L/TNFSF4 antibody 82794-7-RR | Download protocol |
| IHC protocol for OX40L/TNFSF4 antibody 82794-7-RR | Download protocol |
| WB protocol for OX40L/TNFSF4 antibody 82794-7-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









