Osteoprotegerin/TNFRSF11B Polyclonal antibody

• 

  WB analysis using 31766-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31766-1-AP (Osteoprotegerin/TNFRSF11B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat kidney using 31766-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 31766-1-AP (Osteoprotegerin/TNFRSF11B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 31766-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 31766-1-AP (Osteoprotegerin/TNFRSF11B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 31766-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using Osteoprotegerin/TNFRSF11B antibody (31766-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Osteoprotegerin/TNFRSF11B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31766-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

OCIF, OPG, Osteoclastogenesis inhibitory factor, Osteoprotegerin, TNFRSF11B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

31766-1-AP targets Osteoprotegerin/TNFRSF11B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0976

  Product name: Recombinant Human Osteoprotegerin/TNFRSF11B protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-401 aa of NM_002546.4

  Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

• Full Name: tumor necrosis factor receptor superfamily, member 11b
• Calculated Molecular Weight: 46kDa
• Observed Molecular Weight: 56-60 kDa
• GenBank Accession Number: NM_002546.4
• Gene Symbol: TNFRSF11B
• Gene ID (NCBI): 4982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00300
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Osteoprotegerin (OPG), also known as tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) and osteoclastogenesis inhibitory factor (OCIF), belongs to the tumor necrosis factor (TNF) receptor superfamily. By binding to RANKL, OPG inhibits osteoclastic activity and promotes bone formations. OPG plays a key role on cell survival by inhibiting TRAIL-induced apoptosis. OPG also is involved in vascular biology, fibrosis, immunity, EMT, and the apoptosis of cancer cells (PMID: 35523775).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biochem Biophys Res Commun; Apelin-13 treats postmenopausal osteoporosis by reducing mitochondrial oxidative phosphorylation and modulating the OPG/RANK/RANKL/IGF-1 pathway.; Authors - Xiaorong Meng
mouse	IHC	Mol Med Rep; Effects of zinc carnosine on bone loss in mice with diabetic osteoporosis.; Authors - JINGYUAN GAO
rat	WB,IHC	J Orthop Translat; Engineering multifunctional microspheres for sequential regulation of osteoimmune microenvironment and bone remodeling balance to promote regeneration of osteoporotic bone defects.; Authors - Zhiheng Luo