CDKN2A/P16-INK4A Polyclonal antibody

CDKN2A/P16-INK4A Polyclonal Antibody for WB, FC (Intra), IP, ELISA
Cat No. 30519-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), IP, ELISA

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IP detected inHEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30519-1-AP targets CDKN2A/P16-INK4A in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29567

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-156 aa of NM_000077

Sequence: SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberNM_000077
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
RRIDAB_3086346
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).

Protocols

Product Specific Protocols
IP protocol for CDKN2A/P16-INK4A antibody 30519-1-APDownload protocol
WB protocol for CDKN2A/P16-INK4A antibody 30519-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Biochim Biophys Acta Mol Cell Res

Suppression of GATA3 promotes epithelial-mesenchymal transition and simultaneous cellular senescence in human extravillous trophoblasts

Authors - En-Xiang Chen
IHC

Aging Cell

Identifying ENO1 as a protein target of chlorogenic acid to inhibit cellular senescence and prevent skin photoaging in mice

Authors - Xueling He
WB

Front Aging

Tissue-specific effects of bacterial PncA overexpression on NAD+ metabolism and aging in mice: implications for tissue-specific aging interventions

Authors - Fengjiao Huo
humanWB

Tissue Cell

Molecular changes of cellular senescence in dental pulp stem cells during in vitro culture: A potential role of PSG4

Authors - Xiaolin Lyu
Loading...
||
New chat Able
正在加载,请稍候...