Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | HEK-293 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
30519-1-AP targets CDKN2A/P16-INK4A in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29567 Product name: Recombinant human P16-INK4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-156 aa of NM_000077 Sequence: SARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 2A |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | NM_000077 |
| Gene Symbol | CDKN2A |
| Gene ID (NCBI) | 1029 |
| RRID | AB_3086346 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for CDKN2A/P16-INK4A antibody 30519-1-AP | Download protocol |
| WB protocol for CDKN2A/P16-INK4A antibody 30519-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochim Biophys Acta Mol Cell Res Suppression of GATA3 promotes epithelial-mesenchymal transition and simultaneous cellular senescence in human extravillous trophoblasts | ||
Aging Cell Identifying ENO1 as a protein target of chlorogenic acid to inhibit cellular senescence and prevent skin photoaging in mice | ||
Front Aging Tissue-specific effects of bacterial PncA overexpression on NAD+ metabolism and aging in mice: implications for tissue-specific aging interventions | ||
Tissue Cell Molecular changes of cellular senescence in dental pulp stem cells during in vitro culture: A potential role of PSG4 |





