• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CDKN2A/P16-INK4A Polyclonal antibody

CDKN2A/P16-INK4A Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10883

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10883 targets CDKN2A/P16-INK4A in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
RRIDAB_2919007
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42771
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Background

p16 is an important cell cycle regulator and acts as a tumor suppressor. It may also be referred to as one of a number of synonyms, including p16INK4a and cyclin-dependent kinase inhibitor 2A.

 What is the molecular weight of P16?

16kDa. P16 is encoded by the CDKN2A gene in humans and is a chain comprising 148 amino acids.

What is the function of p16?

P16 inhibits cells from progressing from G1 into S phase, binding to cyclin-dependent kinase 4 (CDK4) and inhibiting its kinase ability, so that it cannot phosphorylate the retinoblastoma tumor suppressor (RB). Without this phosphorylation, RB does not activate downstream genes, so the G1/S checkpoint cannot be passed and the cell does not proliferate (PMID: 8259215).

 What is the role of p16 in senescence?

In senescence, cells are irreversibly arrested in the cell cycle. P16 is expressed more highly in aging tissue, is associated with intrinsic cellular aging signals such as telomere shortening, and can therefore be used as a marker of senescence (PMID: 9244355; PMID: 19535234). Due to its role in cell cycle arrest, p16 drives the initiation and maintenance of a cellular senescent phenotype.

 What is the role of p16 in cancer?

As a negative regulator of proliferation, p16 is a known tumor suppressor. Mutations in the CDKN2A gene that lead to inactivation of p16 protein have been associated with an increased risk of cancer and are often observed in primary tumors and in cancer cell lines (PMID: 9508208). The inactivation of p16 has been shown to be a key early stage of tumor progression. In a small number of tumor types that are caused by the human papilloma virus (HPV), p16 is in fact overexpressed when RB is inactivated, releasing p16 and causing an accumulation (PMID: 21297668).


Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CDKN2A/P16-INK4A antibody CL488-10883Download protocol
IF protocol for CL Plus 488 CDKN2A/P16-INK4A antibody CL488-10883Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...