Tested Applications
| Positive WB detected in | Neuro-2a cells, C6 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 27 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
Product Information
27296-1-AP targets P21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26129 Product name: Recombinant human P21;CDKN1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 72-164 aa of BC000275 Sequence: GLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC000275 |
| Gene Symbol | p21 |
| Gene ID (NCBI) | 1026 |
| RRID | AB_2880834 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDKN1A (p21, CIP1, WAF1) is a cyclin-dependent kinase inhibitor. CDKN1A binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at the G1 phase. The expression of CDKN1A is induced by wild-type but not mutant p53 protein, through which CDKN1A mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. CDKN1A can interact with proliferating cell nuclear antigen (PCNA), and plays a regulatory role in S phase DNA replication and DNA damage repair. CDKN1A was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Two alternatively spliced variants, which encode an identical protein, have been reported.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for P21 antibody 27296-1-AP | Download protocol |
| WB protocol for P21 antibody 27296-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Respir Crit Care Med CD38 Mediates Lung Fibrosis by Promoting Alveolar Epithelial Cell Aging | ||
Nat Commun High-content screening identifies ganoderic acid A as a senotherapeutic to prevent cellular senescence and extend healthspan in preclinical models | ||
J Clin Invest Circular RNA circEsyt2 regulates vascular smooth muscle cell remodeling via splicing regulation. | ||
Biomaterials MSC-derived exosomes protect against oxidative stress-induced skin injury via adaptive regulation of the NRF2 defense system. | ||
Cell Mol Life Sci Silencing circSERPINE2 restrains mesenchymal stem cell senescence via the YBX3/PCNA/p21 axis | ||
Oxid Med Cell Longev PIN1 Protects Hair Cells and Auditory HEI-OC1 Cells against Senescence by Inhibiting the PI3K/Akt/mTOR Pathway. |
