P2RX4 Monoclonal antibody, PBS Only

P2RX4 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66416-1-PBS
Clone No.1A5A6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig, rat

Applications

WB, IHC, Indirect ELISA

ATP receptor, P2RX4, P2X purinoceptor 4, P2X4, P2X4R, Purinergic receptor

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66416-1-PBS targets P2RX4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, pig, rat samples.

Tested Reactivity human, mouse, pig, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4445

Product name: Recombinant human P2RX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 57-341 aa of BC033826

Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS

Predict reactive species
Full Name purinergic receptor P2X, ligand-gated ion channel, 4
Calculated Molecular Weight 388 aa, 43 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC033826
Gene Symbol P2RX4
Gene ID (NCBI) 5025
RRIDAB_2881788
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99571
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RX4 (P2X purinoceptor 4) is a receptor for ATP acting as a ligand gated ion channel. The calculated molecular weight of P2RX4 is 43 kDa, larger apparent molecular weights of 50-80 kDa have been reported, possibly due to post-translational glycosylation (PMID: 24040145, 15262999; 29382907; 12566439).

Loading...
||
New chat Able
正在加载,请稍候...