P2RX4 Monoclonal antibody

• 

  WB analysis using 66416-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66416-1-Ig (P2RX4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66416-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66416-1-Ig (P2RX4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 66416-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66416-1-Ig (P2RX4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 66416-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66416-1-Ig (P2RX4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 66416-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66416-1-Ig (P2RX4 Antibody) at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human kidney using 66416-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66416-1-Ig (P2RX4 Antibody) at dilution of 1:400 (under 40x lens).

P2RX4 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66416-1-Ig

Clone No.1A5A6

Publications(2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig, rat

Applications

WB, IHC, ELISA

Synonyms

ATP receptor, P2RX4, P2X purinoceptor 4, P2X4, P2X4R, Purinergic receptor

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, mouse brain tissue, rat brain tissue, rabbit brain tissue, Neuro-2a cells, human brain tissue, pig brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

66416-1-Ig targets P2RX4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig, rat samples.

• Tested Reactivity: human, mouse, pig, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4445

  Product name: Recombinant human P2RX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-341 aa of BC033826

  Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 4
• Calculated Molecular Weight: 388 aa, 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC033826
• Gene Symbol: P2RX4
• Gene ID (NCBI): 5025
• RRID: AB_2881788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RX4 (P2X purinoceptor 4) is a receptor for ATP acting as a ligand gated ion channel. The calculated molecular weight of P2RX4 is 43 kDa, larger apparent molecular weights of 50-80 kDa have been reported, possibly due to post-translational glycosylation (PMID: 24040145, 15262999; 29382907; 12566439).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Clin Transl Med; P2X4 receptor modulates gut inflammation and favours microbial homeostasis in colitis; Authors - Peijie Zhong
mouse	WB	Biochem Pharmacol; Deficiency of purinergic P2X4 receptor alleviates experimental autoimmune hepatitis in mice; Authors - Zejin Liu