Filter: AllWBIHC

WB analysis of Jurkat using 18273-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 18273-1-AP (P2RY1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse heart using 18273-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 18273-1-AP (P2RY1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IHC staining of human testis using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human testis using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human kidney using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human placenta using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human placenta using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human lung using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human ovary using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human ovary using 18273-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 18273-1-AP (P2RY1 antibody) at dilution of 1:50 (under 40x lens).

P2RY1 Polyclonal antibody

Name: P2RY1 Polyclonal antibody
Brand: Proteintech
SKU: 18273-1-AP

P2RY1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18273-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ATP receptor, P2RY1, P2Y purinoceptor 1, P2Y1, Purinergic receptor

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, mouse heart tissue
Positive IHC detected in	human testis tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18273-1-AP targets P2RY1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12992 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species
Full Name	purinergic receptor P2Y, G-protein coupled, 1
Calculated Molecular Weight	373 aa, 42 kDa
Observed Molecular Weight	42 kDa, 57 kDa-59 kDa, 66 kDa
GenBank Accession Number	BC074785
Gene Symbol	P2RY1
Gene ID (NCBI)	5028
RRID	AB_2158402
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P47900
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.