Tested Applications
Positive WB detected in | Jurkat cells, mouse heart tissue |
Positive IHC detected in | human testis tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18273-1-AP targets P2RY1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12992 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species |
Full Name | purinergic receptor P2Y, G-protein coupled, 1 |
Calculated Molecular Weight | 373 aa, 42 kDa |
Observed Molecular Weight | 42 kDa, 57 kDa-59 kDa, 66 kDa |
GenBank Accession Number | BC074785 |
Gene Symbol | P2RY1 |
Gene ID (NCBI) | 5028 |
RRID | AB_2158402 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P47900 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for P2RY1 antibody 18273-1-AP | Download protocol |
IHC protocol for P2RY1 antibody 18273-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |