P2RY13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P2RY13 Polyclonal antibody (20335-1-AP)

P2RY13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20335-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

FKSG77, GPCR1, GPR86, GPR94, G-protein coupled receptor 86

• 

  WB analysis using 20335-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20335-1-AP (P2RY13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 20335-1-AP

  WB result of P2RY13 antibody (20335-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-P2RY13 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 20335-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20335-1-AP (P2RY13 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 20335-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20335-1-AP (P2RY13 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for P2RY13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20335-1-AP targets P2RY13 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14108

  Product name: Recombinant human P2RY13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-333 aa of BC041116

  Sequence: ARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG

• Full Name: purinergic receptor P2Y, G-protein coupled, 13
• Calculated Molecular Weight: 354 aa, 41 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC041116
• Gene Symbol: P2RY13
• Gene ID (NCBI): 53829
• RRID: AB_2878674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P2RY13 (also named GPR86 or GPR94) is a G protein-coupled receptor (GPCR), which is involved in the pathogenesis of inflammation and immune disorders (PMID: 35982893). Several studies have reported that P2RY13 is a key regulator of cholesterol transport and hepatic HDL endocytosis and is involved in bone formation, remodeling, cell survival, and neuroprotection (PMID: 38045624).

Publications

What published studies show

The P2RY13 Polyclonal antibody (Cat# 20335-1-AP) has 3 citations published in Nature Methods, Cancers (Basel), and Health Science Reports. The cited research spans single-cell transcriptomics of small extracellular vesicles, tumor-associated macrophage biology and NETosis in cancer prognosis, and immune infiltrate analysis in renal clear cell carcinoma. Applications used include WB, IHC, and IF in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Methods; SEVtras delineates small extracellular vesicles at droplet resolution from single-cell transcriptomes; Authors - Ruiqiao He
human	WB,IHC,IF	Cancers (Basel); P2RY13-Negative Tumor-Associated Macrophages Promote NETosis and Are Associated with Poor Prognosis Across Multiple Cancers.; Authors - Shen Yang ; KD Validated
human	IHC	Health Sci Rep; P2RY13 is a prognostic biomarker and associated with immune infiltrates in renal clear cell carcinoma: A comprehensive bioinformatic study; Authors - Jie Chu