P2RY13 Polyclonal antibody

• 

  WB analysis using 20335-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20335-1-AP (P2RY13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 20335-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20335-1-AP (P2RY13 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human small intestine using 20335-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20335-1-AP (P2RY13 Antibody) at dilution of 1:50 (under 40x lens).

P2RY13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20335-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FKSG77, GPCR1, GPR86, GPR94, G-protein coupled receptor 86

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

20335-1-AP targets P2RY13 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14108

  Product name: Recombinant human P2RY13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 253-333 aa of BC041116

  Sequence: ARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG

• Full Name: purinergic receptor P2Y, G-protein coupled, 13
• Calculated Molecular Weight: 354 aa, 41 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC041116
• Gene Symbol: P2RY13
• Gene ID (NCBI): 53829
• RRID: AB_2878674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P2RY13 (also named GPR86 or GPR94) is a G protein-coupled receptor (GPCR), which is involved in the pathogenesis of inflammation and immune disorders (PMID: 35982893). Several studies have reported that P2RY13 is a key regulator of cholesterol transport and hepatic HDL endocytosis and is involved in bone formation, remodeling, cell survival, and neuroprotection (PMID: 38045624).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Health Sci Rep; P2RY13 is a prognostic biomarker and associated with immune infiltrates in renal clear cell carcinoma: A comprehensive bioinformatic study; Authors - Jie Chu
human	WB	Nat Methods; SEVtras delineates small extracellular vesicles at droplet resolution from single-cell transcriptomes; Authors - Ruiqiao He