Tested Applications
| Positive WB detected in | HepG2 cells |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
20335-1-AP targets P2RY13 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14108 Product name: Recombinant human P2RY13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 253-333 aa of BC041116 Sequence: ARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG Predict reactive species |
| Full Name | purinergic receptor P2Y, G-protein coupled, 13 |
| Calculated Molecular Weight | 354 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC041116 |
| Gene Symbol | P2RY13 |
| Gene ID (NCBI) | 53829 |
| RRID | AB_2878674 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BPV8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
P2RY13 (also named GPR86 or GPR94) is a G protein-coupled receptor (GPCR), which is involved in the pathogenesis of inflammation and immune disorders (PMID: 35982893). Several studies have reported that P2RY13 is a key regulator of cholesterol transport and hepatic HDL endocytosis and is involved in bone formation, remodeling, cell survival, and neuroprotection (PMID: 38045624).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for P2RY13 antibody 20335-1-AP | Download protocol |
| WB protocol for P2RY13 antibody 20335-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Health Sci Rep P2RY13 is a prognostic biomarker and associated with immune infiltrates in renal clear cell carcinoma: A comprehensive bioinformatic study | ||
Nat Methods SEVtras delineates small extracellular vesicles at droplet resolution from single-cell transcriptomes |







