Tested Applications
Positive WB detected in | HeLa cells |
Positive IHC detected in | human testis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
Product Information
26691-1-AP targets P3H1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24904 Product name: Recombinant human LEPRE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-109 aa of BC108311 Sequence: EVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSF Predict reactive species |
Full Name | leucine proline-enriched proteoglycan (leprecan) 1 |
Calculated Molecular Weight | 83 kDa |
Observed Molecular Weight | 83 kDa |
GenBank Accession Number | BC108311 |
Gene Symbol | LEPRE1/P3H1 |
Gene ID (NCBI) | 64175 |
RRID | AB_2880605 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q32P28 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
P3H1 (prolyl 3-hydroxylase 1, also known as LEPRE1) is a member of the leprecan family of proteins, which also include P3H2, P3H3, CRTAP and SC56. Collagen prolyl hydroxylases are required for proper collagen biosynthesis, folding, and assembly. P3H1 is localized to the endoplasmic reticulum and has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. Mutations in this gene are associated with osteogenesis imperfecta type VIII.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for P3H1 antibody 26691-1-AP | Download protocol |
IHC protocol for P3H1 antibody 26691-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Oncol The Prognostic Significance and Potential Mechanism of Prolyl 3-Hydroxylase 1 in Hepatocellular Carcinoma | ||
Acta Biomater Matrix produced by diseased cardiac fibroblasts affects early myotube formation and function | ||
NPJ Precis Oncol Multi-omics analysis of Prolyl 3-hydroxylase 1 as a prognostic biomarker for immune infiltration in ccRCC |