• Featured Product
  • KD/KO Validated

P53 Polyclonal antibody

This P53 antibody (10442-1-AP) is a rabbit polyclonal antibody that targets P53 in WB, IHC, IF/ICC, IP, ELISA and is suitable for human, rat samples. The 10442-1-AP antibody has 1,211 publication citations.

Cat No. 10442-1-AP
Publications(1211)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (7)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

TP53, Tumour Protein p53, Tumor suppressor p53, tumor protein p53, Antigen NY-CO-13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, SMMC-7721 cells, MCF-7 cells, rat colon tissue, HEK-293 cells, HT-29 cells, HepG2 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10442-1-AP targets P53 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat, pig, rabbit, monkey, chicken, zebrafish, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0698

Product name: Recombinant human P53 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-232 aa of BC003596

Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI

Predict reactive species
Full Name tumor protein p53
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC003596
Gene Symbol P53
Gene ID (NCBI) 7157
RRIDAB_2206609
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1.       What is p53?

P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.

2.       FAQs and p53

a.       I fail to detect p53 by western blotting

Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.

b.      I fail to detect p53 in some cell lines by western blotting

Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.

c.       I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size

p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.


Protocols

Product Specific Protocols
IF protocol for P53 antibody 10442-1-APDownload protocol
IHC protocol for P53 antibody 10442-1-APDownload protocol
IP protocol for P53 antibody 10442-1-APDownload protocol
WB protocol for P53 antibody 10442-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Nat Med

A biobank of patient-derived pediatric brain tumor models.

Authors - Sebastian Brabetz
rat,humanWB

ACS Nano

Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA.

Authors - Meng Zhao
WB

Nat Commun

High-content screening identifies ganoderic acid A as a senotherapeutic to prevent cellular senescence and extend healthspan in preclinical models

Authors - Li Chen
humanWB,IHC

Nat Commun

URI alleviates tyrosine kinase inhibitors-induced ferroptosis by reprogramming lipid metabolism in p53 wild-type liver cancers

Authors - Zhiwen Ding
humanWB

Sci Transl Med

PTEN status determines chemosensitivity to proteasome inhibition in cholangiocarcinoma.

Authors - Tian-Yi Jiang
humanWB

Cell Res

DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.

Authors - Pengli Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Courtney (Verified Customer) (08-28-2025)

Bands turned out great with no background. I didn't have to do any optimizing.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RPTEC
P53 Antibody Western Blot validation (1:2000 dilution) in RPTEC (Cat no:10442-1-AP)
FH

Angelique (Verified Customer) (06-26-2025)

very nice expression

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: human immortalized coronary artery smooth muscle cells
FH

Laetitia (Verified Customer) (03-21-2024)

Finding antibodies specific to avian proteins is very difficult. I have tried different antibodies from different companies so far. This antibody is by far the best (cost efficient as well)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Epithelial chicken cells
FH

Macarena Lucia (Verified Customer) (10-17-2022)

clear band on human lysates

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Kimberly (Verified Customer) (04-08-2022)

TRIS antigen retrieval

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: colon tissue, human and mouse
FH

Ryan (Verified Customer) (08-27-2021)

Worked well in HeLa cells and provided a nice clear band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3500
  • Cell Tissue Type: HeLa Cells
FH

Fan (Verified Customer) (03-22-2021)

Mouse retinal tissue was used. Single band at the right size was detected. Good antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
P53 Antibody Western Blot validation (1:500 dilution) in (Cat no:10442-1-AP)
FH

WEI (Verified Customer) (01-17-2020)

Weak band in heart lysates

  • Applications: Western Blot,
  • Cell Tissue Type: Mouse Heart
FH

Ben (Verified Customer) (09-26-2019)

It worked very well for our westerns.

  • Applications: Western Blot,
FH

Sid (Verified Customer) (04-12-2019)

Product performed well in western for human samples, moderate background/non specific binding

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human embryonic kidney
FH

Josiah (Verified Customer) (02-27-2019)

Antibody performed superb in a Western Blot application. Used Licor IR secondary antibodies to label the p53 antibody along with ß-actin as a duplex assay and imaged on a Licor Odyssey FC.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: T8
P53 Antibody Western Blot, validation (1:1000 dilution) in T8 (Cat no:10442-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...