Tested Applications
| Positive WB detected in | A431 cells, SMMC-7721 cells, MCF-7 cells, rat colon tissue, HEK-293 cells, HT-29 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10442-1-AP targets P53 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, rat, pig, rabbit, canine, monkey, chicken, goat, artemia sinica |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0698 Product name: Recombinant human P53 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC003596 Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI Predict reactive species |
| Full Name | tumor protein p53 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC003596 |
| Gene Symbol | P53 |
| Gene ID (NCBI) | 7157 |
| RRID | AB_2206609 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04637 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
1. What is p53?
P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.
2. FAQs and p53
a. I fail to detect p53 by western blotting
Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.
b. I fail to detect p53 in some cell lines by western blotting
Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.
c. I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size
p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for P53 antibody 10442-1-AP | Download protocol |
| IHC protocol for P53 antibody 10442-1-AP | Download protocol |
| IP protocol for P53 antibody 10442-1-AP | Download protocol |
| WB protocol for P53 antibody 10442-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA. | ||
Nat Commun High-content screening identifies ganoderic acid A as a senotherapeutic to prevent cellular senescence and extend healthspan in preclinical models | ||
Nat Commun URI alleviates tyrosine kinase inhibitors-induced ferroptosis by reprogramming lipid metabolism in p53 wild-type liver cancers | ||
Sci Transl Med PTEN status determines chemosensitivity to proteasome inhibition in cholangiocarcinoma. | ||
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Courtney (Verified Customer) (08-28-2025) | Bands turned out great with no background. I didn't have to do any optimizing.
![]() |
FH Angelique (Verified Customer) (06-26-2025) | very nice expression
|
FH Laetitia (Verified Customer) (03-21-2024) | Finding antibodies specific to avian proteins is very difficult. I have tried different antibodies from different companies so far. This antibody is by far the best (cost efficient as well)
|
FH Macarena Lucia (Verified Customer) (10-17-2022) | clear band on human lysates
|
FH Kimberly (Verified Customer) (04-08-2022) | TRIS antigen retrieval
|
FH Ryan (Verified Customer) (08-27-2021) | Worked well in HeLa cells and provided a nice clear band.
|
FH Fan (Verified Customer) (03-22-2021) | Mouse retinal tissue was used. Single band at the right size was detected. Good antibody.
![]() |
FH WEI (Verified Customer) (01-17-2020) | Weak band in heart lysates
|
FH Ben (Verified Customer) (09-26-2019) | It worked very well for our westerns.
|
FH Sid (Verified Customer) (04-12-2019) | Product performed well in western for human samples, moderate background/non specific binding
|
FH Josiah (Verified Customer) (02-27-2019) | Antibody performed superb in a Western Blot application. Used Licor IR secondary antibodies to label the p53 antibody along with ß-actin as a duplex assay and imaged on a Licor Odyssey FC.
![]() |


























