PABPC1L Polyclonal antibody

• 

  WB analysis using 31907-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31907-1-AP (PABPC1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31907-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31907-1-AP (PABPC1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PABPC1L Polyclonal Antibody for WB, ELISA

Cat No. 31907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Polyadenylate-binding protein 1-like

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31907-1-AP targets PABPC1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36248

  Product name: Recombinant human PABPC1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-530 aa of NM_001124756

  Sequence: RLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEP

• Full Name: poly(A) binding protein, cytoplasmic 1-like
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001124756
• Gene Symbol: PABPC1L
• Gene ID (NCBI): 80336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAP1L, also known as PABPC1L, is a human gene that has been associated with various cellular processes, particularly in the context of reproduction and embryonic development. PABPC1L was markedly upregulated in RCC, and high PABPC1L expression correlated with unfavorable prognosis and resistance to ICB (PMID: 38382068).