PACSIN1 Monoclonal antibody

PACSIN1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 68115-1-Ig
Clone No.1B7B4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

1B7B4, KIAA1379, SDPI, Syndapin-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue
Positive IHC detected inmouse cerebellum tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68115-1-Ig targets PACSIN1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4102

Product name: Recombinant human PACSIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 243-389 aa of BC040228

Sequence: VFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVR

Predict reactive species
Full Name protein kinase C and casein kinase substrate in neurons 1
Calculated Molecular Weight 444 aa, 51 kDa
Observed Molecular Weight 48-51 kDa
GenBank Accession NumberBC040228
Gene Symbol PACSIN1
Gene ID (NCBI) 29993
RRIDAB_2923644
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BY11
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PACSIN1 (also known as syndapin-1) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family. In mammals, the PACSIN family is comprised of three members, PACSIN1, PACSIN2, and PACSIN3 (PMID: 34990060). PACSIN1 is expressed mainly in neurons, whereas PACSIN2 is ubiquitously expressed in all tissues, and PACSIN3 is expressed mainly in skeletal muscle and the heart (PMID: 23668323). All of these three members contain an N-terminal F-BAR domain and a C-terminal SH3 domain. PACSIN1 plays a role in endocytosis and endosomal recycling. Meanwhile, it has a role in actin remodeling and microtubule nucleation and also plays a particular role in membrane shaping and reconstruction (PMID: 23035120; 34422904). PACSIN1 is involved in neuromorphogenesis and the regulation of the nervous system, and the inappropriate expression of PACSIN1 has been associated with some neurological diseases, including schizophrenia, Alzheimer's disease, and Huntington's disease (PMID: 34990060).

Protocols

Product Specific Protocols
IF protocol for PACSIN1 antibody 68115-1-IgDownload protocol
IHC protocol for PACSIN1 antibody 68115-1-IgDownload protocol
WB protocol for PACSIN1 antibody 68115-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...