• Featured Product
  • KD/KO Validated

PADI2 Polyclonal antibody

PADI2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 12110-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, COIP, ELISA, Blocking assay

EC:3.5.3.15, KIAA0994, PAD H19, PAD2, PAD-H19

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, MCF-7 cells, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inBxPC-3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12110-1-AP targets PADI2 in WB, IHC, IF/ICC, IF-P, IP, COIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2755

Product name: Recombinant human PADI2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-438 aa of BC009701

Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL

Predict reactive species
Full Name peptidyl arginine deiminase, type II
Calculated Molecular Weight 665 aa, 75 kDa
Observed Molecular Weight 70-75 kDa, 50 kDa
GenBank Accession NumberBC009701
Gene Symbol PADI2
Gene ID (NCBI) 11240
RRIDAB_2159475
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y2J8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PADI2, also named as KIAA0994, PDI2, PAD-H19, and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation-related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa.

Protocols

Product Specific Protocols
IF protocol for PADI2 antibody 12110-1-APDownload protocol
IHC protocol for PADI2 antibody 12110-1-APDownload protocol
IP protocol for PADI2 antibody 12110-1-APDownload protocol
WB protocol for PADI2 antibody 12110-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Sci Transl Med

Neutrophil extracellular traps, B cells, and type I interferons contribute to immune dysregulation in hidradenitis suppurativa.

Authors - Angel S Byrd
humanWB

Mol Cell

Arginine Citrullination at the C-Terminal Domain Controls RNA Polymerase II Transcription.

Authors - Priyanka Sharma
  • KD Validated
humanWB

Pharmacol Res

Curcumin modulates β-catenin stabilization via targeting proteasomal deubiquitinating enzyme USP14

Authors - Mengzhen Shen
mouseWB

J Immunother Cancer

PAD-2-mediated citrullination of nucleophosmin provides an effective target for tumor immunotherapy.

Authors - Ruhul H Choudhury
  • KO Validated
mouseWB,IF

Angiogenesis

Angiogenic responses in a 3D micro-engineered environment of primary endothelial cells and pericytes.

Authors - Jing Bai
  • KD Validated
humanWB

Proc Natl Acad Sci U S A

Peptidylarginine deiminase 2-catalyzed histone H3 arginine 26 citrullination facilitates estrogen receptor α target gene activation.

Authors - Zhang Xuesen X

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Michael (Verified Customer) (07-23-2025)

This lab uses several different antibodies across multiple projects.

  • Applications: Western Blot, Cell culture
PADI2 Antibody Western Blot,Cell culture validation ( dilution) in (Cat no:12110-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...