PAEP/Glycodelin Recombinant monoclonal antibody, PBS Only

• 

PAEP/Glycodelin Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85856-1-PBS

Clone No.250206F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

Glycodelin, PAEP, GD, GdF, GdS

---

Product Information

85856-1-PBS targets PAEP/Glycodelin in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3037

  Product name: Recombinant Human PAEP/Glycodelin protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-180 aa of NM_002571.4

  Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

• Full Name: progestagen-associated endometrial protein
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: NM_002571.4
• Gene Symbol: PAEP/Glycodelin
• Gene ID (NCBI): 5047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09466-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.