PAK7 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

PAK7 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 82935-2-PBS
Clone No.230201A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

PAK4/6/7, EC:2.7.11.1, KIAA1264, p21-activated kinase 5, p21-activated kinase 7

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82935-2-PBS targets PAK7 as part of a matched antibody pair:

MP00086-1: 82935-2-PBS capture and 82935-4-PBS detection (validated in Cytometric bead array)

MP00086-2: 82935-2-PBS capture and 82935-5-PBS detection (validated in Cytometric bead array)

MP00086-3: 82935-3-PBS capture and 82935-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29190

Product name: Recombinant human PAK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 180-360 aa of BC024179

Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS

Predict reactive species
Full Name p21 protein (Cdc42/Rac)-activated kinase 7
Calculated Molecular Weight 719 aa, 81 kDa
GenBank Accession NumberBC024179
Gene Symbol PAK7
Gene ID (NCBI) 57144
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P286
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...