Tested Applications
| Positive WB detected in | mouse lung tissue, mouse spleen tissue, PC-3 cells |
| Positive IHC detected in | human skeletal muscle tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
Product Information
26604-1-AP targets PANX2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24256 Product name: Recombinant human PANX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 70-170 aa of BC101023 Sequence: ESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATD Predict reactive species |
| Full Name | pannexin 2 |
| Calculated Molecular Weight | 677 aa, 74 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC101023 |
| Gene Symbol | PANX2 |
| Gene ID (NCBI) | 56666 |
| RRID | AB_2880572 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RD6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pannexins (Panx) are proteins homologous to the invertebrate gap junction proteins called innexins (Inx) and are traditionally described as transmembrane channels. Three distinct Panx paralogs (Panx1, Panx2 and Panx3) have been identified in vertebrates. Previous reports on Panx expression and functionality are focused primarily on Panx1 and Panx3 proteins. The exact function of Panx2 remains elusive. Catalog#26604-1-AP specially recognizes the 70 kDa Panx2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PANX2 antibody 26604-1-AP | Download protocol |
| WB protocol for PANX2 antibody 26604-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nan Fang Yi Ke Da Xue Xue Bao [Down-regulation of pannexin 2 channel enhances cisplatin-induced apoptosis in testicular cancer I-10 cells].
| ||
Exp Cell Res PANX2 promotes malignant transformation of colorectal cancer and 5-Fu resistance through PI3K-AKT signaling pathway
|













