Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, SW480 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24966-1-AP targets PAQR7 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21655 Product name: Recombinant human PAQR7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC034015 Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQH Predict reactive species |
| Full Name | progestin and adipoQ receptor family member VII |
| Calculated Molecular Weight | 346 aa, 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC034015 |
| Gene Symbol | PAQR7 |
| Gene ID (NCBI) | 164091 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86WK9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Progestin and adipoQ receptor 7 (PAQR7), also called membrane P4 receptor α (mPRα), is a membrane protein with seven transmembrane domains, similar to G protein-coupled receptors (PMID: 34217103). Studies have shown that PAQR7 has important physiological functions in various reproductive tissues (PMID: 12601167). In addition, PAQR7 participates in the antimitotic action of P4 in human GCs and luteal cells, and P4's ability to suppress entry into the cell cycle was dependent on PAQR7 but not nuclear progesterone receptor (PGR) (PMID: 26203174).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PAQR7 antibody 24966-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

