PARP14 Polyclonal antibody

• 

  IHC staining of human placenta using 30127-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30127-1-AP (PARP14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 30127-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30127-1-AP (PARP14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PARP14 Polyclonal Antibody for IHC, ELISA

Cat No. 30127-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

BAL2, KIAA1268, PARP 14

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30127-1-AP targets PARP14 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32409

  Product name: Recombinant human PARP14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1501-1640 aa of NM_017554

  Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC

• Full Name: poly (ADP-ribose) polymerase family, member 14
• Calculated Molecular Weight: 203kd
• GenBank Accession Number: NM_017554
• Gene Symbol: PARP14
• Gene ID (NCBI): 54625
• RRID: AB_3086239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q460N5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP14 (poly (ADP-ribose) polymerase family, member 14) is a PARP family member that has roles in DNA repair, B cell regulation, and focal adhesion (PMID: 25753673). The largest of all the human PARPs is PARP14. PARP14 has been reported to regulate several different pathways involved in immunity, inflammation, and genome stability (PMID: 37703374).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Phytomedicine; Pterosin B improves cognitive dysfunction by promoting microglia M1/M2 polarization through inhibiting Klf5/Parp14 pathway; Authors - Yan Zhang