PARP14 Polyclonal antibody

PARP14 Polyclonal Antibody for IHC, ELISA
Cat No. 30127-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

BAL2, KIAA1268, PARP 14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

30127-1-AP targets PARP14 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32409

Product name: Recombinant human PARP14 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1501-1640 aa of NM_017554

Sequence: SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTC

Predict reactive species
Full Name poly (ADP-ribose) polymerase family, member 14
Calculated Molecular Weight203kd
GenBank Accession NumberNM_017554
Gene Symbol PARP14
Gene ID (NCBI) 54625
RRIDAB_3086239
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ460N5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP14 (poly (ADP-ribose) polymerase family, member 14) is a PARP family member that has roles in DNA repair, B cell regulation, and focal adhesion (PMID: 25753673). The largest of all the human PARPs is PARP14. PARP14 has been reported to regulate several different pathways involved in immunity, inflammation, and genome stability (PMID: 37703374).

Protocols

Product Specific Protocols
IHC protocol for PARP14 antibody 30127-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Phytomedicine

Pterosin B improves cognitive dysfunction by promoting microglia M1/M2 polarization through inhibiting Klf5/Parp14 pathway

Authors - Yan Zhang
Loading...
||
New chat Able
正在加载,请稍候...