PARP6 Polyclonal antibody

• 

  WB analysis of HepG2 using 16945-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16945-1-AP (PARP6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16945-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16945-1-AP (PARP6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

PARP6 Polyclonal Antibody for WB, ELISA

Cat No. 16945-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ADP-ribosyltransferase diphtheria toxin-like 17, ARTD17, EC:2.4.2.-, PARP 6, PARP-6

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16945-1-AP targets PARP6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10556

  Product name: Recombinant human PARP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC015176

  Sequence: MGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN

• Full Name: poly (ADP-ribose) polymerase family, member 6
• Calculated Molecular Weight: 71 kDa, 58 kDa, 43 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC015176
• Gene Symbol: PARP6
• Gene ID (NCBI): 56965
• RRID: AB_2158918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2NL67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.