Use Able AI chat for product recommendations

PAX3 Polyclonal antibody

PAX3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 21386-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

CDHS, paired box 3, Paired box protein Pax 3, Paired box protein Pax-3, PAX-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, mouse skin tissue, B16 cells, F9 cells, SK-MEL-30 cells, U-87 MG cells
Positive IP detected inmouse skin tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21386-1-AP targets PAX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16021

Product name: Recombinant human PAX3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 341-426 aa of BC101301

Sequence: QSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVS

Predict reactive species
Full Name paired box 3
Calculated Molecular Weight 484 aa, 53 kDa
Observed Molecular Weight 56-60 kDa
GenBank Accession NumberBC101301
Gene Symbol PAX3
Gene ID (NCBI) 5077
RRIDAB_10732817
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23760
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX3, a transcription factor and multifunctional regulatory protein, is normally expressed during embryonic development. In the nervous system, PAX3 is involved in neural tube closure, neural crest development, and peripheral neuron differentiation. In the present study, PAX3 was reported as a novel regulator of GFAP transcription, and the overexpression and suppression of PAX3 could inhibit and promote NSC differentiation, respectively. In muscle development, PAX3 ensures the survival of myogenic progenitor cells with Pax3-expressing progenitors giving rise to both skeletal and smooth muscle cells. PAX3 also has a well-established role in the development of melanocytes during embryogenesis, and has recently been characterized as a molecular switch in the mature melanocyte. Mutations in PAX3 can cause Waardenburg syndrome.

Protocols

Product Specific Protocols
IP protocol for PAX3 antibody 21386-1-APDownload protocol
WB protocol for PAX3 antibody 21386-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
hamsterIHC

Birth Defects Res

Cigarette smoke induced neural tube defects by down-regulating noggin expression.

Authors - Chuanhui Yin

Neurogastroenterol Motil

Electroacupuncture Improves Anorectal Function in Neurogenic Fecal Incontinence Rats, Related to Reversing Anal Sphincter Atrophy and Enhancing Muscle Satellite Cell Activity

Authors - Jinchao He

Adv Sci (Weinh)

RPS27L Enhances Myogenesis and Muscle Mass by Targeting IGF1 Through Liquid-Liquid Phase Separation

Authors - Xiaoqin Liu
humanWB

Stem Cells Int

Noggin Combined With Human Dental Pulp Stem Cells to Promote Skeletal Muscle Regeneration

Authors - Meng-Han Zhang
mouseWB

Neurochem Int

Cycloleucine induces neural tube defects by reducing Pax3 expression and impairing the balance of proliferation and apoptosis in early neurulation

Authors - Li Zhang
Loading...
||
New chat

Able

正在加载,请稍候...